PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.GQI2P
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 310aa    MW: 33995.5 Da    PI: 9.9663
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.GQI2PgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.14e-13101145347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r +   Rt+ q+ s+ qky
      Aradu.GQI2P 101 PWTEEEHRMFLVGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKY 145
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.515320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.20894150IPR017930Myb domain
SuperFamilySSF466892.99E-1796151IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-1997149IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-1198144IPR009057Homeodomain-like
SMARTSM007171.1E-1098148IPR001005SANT/Myb domain
CDDcd001674.59E-9101146No hitNo description
PfamPF002491.0E-10101145IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPN RGGGGVKLFG VRLTDGSIIK KSASMGNLMT LHHHCSSPSS  60
SFVATAGDNP GSPDPVGYLS DDPAHASSFA NRRGERKKGV PWTEEEHRMF LVGLQKLGKG  120
DWRGISRNFV VSRTPTQVAS HAQKYFIRQS NATRRKRRSS LFDMAPDMPT EPPSVLEKQV  180
LLLTSENSQS PNVKSQPSLN LSLKSEVDPM EIASEENVKE NNVANGLKTK APEYFPTYVP  240
VQFSIWPSLE ASFQESNGVE TSHHEVVKPI PVVPKNPVNV DALVGMSNLS IGNTQMILKR  300
EPSPLSLKLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-63AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015932709.10.0PREDICTED: uncharacterized protein LOC107459000
TrEMBLA0A151SHD31e-152A0A151SHD3_CAJCA; Myb-like protein J
STRINGGLYMA13G43120.11e-150(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.12e-83MYB_related family protein